Total number of results for Drosophila melanogaster are 83
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00061 |
ELTFSPDW
|
8 | Drosophila melanogaster | AKH/HRTH/RPCH | Adipokinetic hormone | 2117437#Schaffer MH, Noyes BE, Slaughter CA, Thorne GC, Gaskell SJ#The fruitfly Drosophila melanogaster contains a novel charged adipokinetic-hormone-family peptide#Biochem J 1990 Jul 15;269(2):315-20 | |
| NP00097 |
QLTFSPDWGK
|
10 | Drosophila melanogaster | AKH/HRTH/RPCH | Adipokinetic hormone | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP00143 |
QLTFSPDW
|
8 | Drosophila melanogaster | AKH/HRTH/RPCH | Adipokinetic hormone | 2117437#Schaffer M.H., Noyes B.E., Slaughter C.A., Thorne G.C., Gaskell S.J.; # The fruitfly Drosophila melanogaster contains a novel charged adipokinetic-hormone-family peptide.; # Biochem. J. 269:315-320(1990).$12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00253 |
EVRYRQCYFNPISCF
|
15 | Drosophila melanogaster | Allatostatin | Allatostatin C | 12479379#Kaminski S, Orlowski E, Berry K, Nichols R#The effects of three Drosophila melanogaster myotropins on the frequency of foregut contractions differ#J Neurogenet 2002 Apr-Jun;16(2):125-34 | |
| NP00400 |
EAQGWNKFRGAW
|
12 | Drosophila melanogaster | Allatostatin | MIP3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00564 |
VERYAFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-1 (Potential) | ||
| NP00565 |
LPVYNFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-2 (Potential) | ||
| NP00566 |
SRPYSFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-3 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00567 |
TTRPQPFNFGL
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-4 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00568 |
AYMYTNGGPGM
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00569 |
AWQSLQSSW
|
9 | Drosophila melanogaster | Allatostatin | Drostatin-B1 (Potential) | ||
| NP00570 |
AWKSMNVAW
|
9 | Drosophila melanogaster | Allatostatin | Drostatin-B2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00571 |
RQAQGWNKFRGAW
|
13 | Drosophila melanogaster | Allatostatin | Drostatin-B3 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP00572 |
EPTWNNLKGMW
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-B4 (Potential) | ||
| NP00573 |
DQWQKLHGGW
|
10 | Drosophila melanogaster | Allatostatin | Drostatin-B5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP00894 |
PFCNAFTGC
|
9 | Drosophila melanogaster | CCAP | Cardioactive peptide (By similarity) | ||
| NP01031 |
FQYSRGWTN
|
9 | Drosophila melanogaster | Corazonin | Corazonin3-11 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP01058 |
QTFQYSRGWTN
|
11 | Drosophila melanogaster | Corazonin | Corazonin | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP01059 |
SFNAASPLLANGHLHRASELGLTDLYDLQDWSSD
|
34 | Drosophila melanogaster | Corazonin | Corazonin precursor-related peptide | ||
| NP01060 |
QTFQYSRGWTNGKRSFNAASPLLANGHLHRASELGLTDLYDLQDWSSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPENSAHPRLSNSNGENVLYSSANIPNRHRQSNELLEELSAAGGASAEPNVFGKH
|
135 | Drosophila melanogaster | Corazonin | Pro-corazonin (Potential) | ||
| NP01112 |
DDSSPGFFLKITKNVPRL
|
18 | Drosophila melanogaster | Ecdysis triggering hormone | Ecdysis triggering hormone 1 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP01113 |
GENFAIKNLKTIPRI
|
15 | Drosophila melanogaster | Ecdysis triggering hormone | Ecdysis-triggering hormone 2 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP01173 |
DEGHKMLYF
|
9 | Drosophila melanogaster | FMRFamide related peptide | FMRFamide-related peptide | 10818250#Johnson E, Ringo J, Dowse H#Native and heterologous neuropeptides are cardioactive in Drosophila melanogaster#J Insect Physiol 2000 Aug 1;46(8):1229-1236 | |
| NP01473 |
AYRKPPFNGSIF
|
12 | Drosophila melanogaster | FMRFamide related peptide | SIFamide | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP01707 |
AAMDRY
|
6 | Drosophila melanogaster | FMRFamide related peptide | AAMDRY-amide | ||
| NP01708 |
QAEQLPPEGSYAGSDELEGMA
|
21 | Drosophila melanogaster | FMRFamide related peptide | Corticotropin-releasing factor-like | ||
| NP01709 |
DPKQDFMRF
|
9 | Drosophila melanogaster | FMRFamide related peptide | DPKQDFMRF-amide | ||
| NP01710 |
SVQDNFMHF
|
9 | Drosophila melanogaster | FMRFamide related peptide | FMRFamide A | ||
| NP01711 |
MDSNFIRF
|
8 | Drosophila melanogaster | FMRFamide related peptide | MDSNFIRF-amide | ||
| NP01712 |
PDNFMRF
|
7 | Drosophila melanogaster | FMRFamide related peptide | PDNFMRF-amide | ||
| NP01713 |
SAPQDFVRS
|
9 | Drosophila melanogaster | FMRFamide related peptide | SAPQDFVRS-amide | ||
| NP01714 |
SDNFMRF
|
7 | Drosophila melanogaster | FMRFamide related peptide | SDNFMRF-amide | ||
| NP01715 |
SPKQDFMRF
|
9 | Drosophila melanogaster | FMRFamide related peptide | SPKQDFMRF-amide | ||
| NP01716 |
TPAEDFMRF
|
9 | Drosophila melanogaster | FMRFamide related peptide | TPAEDFMRF-amide | ||
| NP02099 |
NQKTMSF
|
7 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02100 |
FDDYGHMRF
|
9 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02101 |
GGDDQFDDYGHMRF
|
14 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP02821 |
NSVVLGKKQRFHSWG
|
15 | Drosophila melanogaster | Kinin | Leucokinin | 10574744# Terhzaz S., O'Connell F.C., Pollock V.P., Kean L., Davies S.A., Veenstra J.A., Dow J.A.T.; #Isolation and characterization of a leucokinin-like peptide of Drosophila melanogaster.; # J. Exp. Biol. 202:3667-3676(1999).$12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP03051 |
QDVDHVFLRF
|
10 | Drosophila melanogaster | Myosuppressin | Leucomyosuppressin | 9318083#Robb S, Evans P#THE MODULATORY EFFECT OF SCHISTOFLRFamide ON HEART AND SKELETAL MUSCLE IN THE LOCUST SCHISTOCERCA GREGARIA#J Exp Biol 1994 Dec;197(1):437-42 | |
| NP03077 |
TDVDHVFLRF
|
10 | Drosophila melanogaster | Myosuppressin | Myosuppressin | 1390001# Nichols R.; #Isolation and structural characterization of Drosophila TDVDHVFLRFamide and FMRFamide-containing neural peptides.; # J. Mol. Neurosci. 3:213-218(1992).$12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP03116 |
RYLPT
|
5 | Drosophila melanogaster | NA | Proctolin | 12846841#Mazzocco C, Fukasawa KM, Auguste P, Puiroux J#Characterization of a functionally expressed dipeptidyl aminopeptidase III from Drosophila melanogaster#Eur J Biochem 2003 Jul;270(14):3074-82 | |
| NP03380 |
SVAALAAQGLLNAPK
|
15 | Drosophila melanogaster | NA | APK peptide | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03532 |
RVVSGSKGSAALALCRQFEQLSAS
|
24 | Drosophila melanogaster | NA | Amnesiac peptide 24 (Potential) | ||
| NP03533 |
ERAEECRTTQLRYHYHRNGAQSRSLCAAVLCC
|
32 | Drosophila melanogaster | NA | Amnesiac peptide 30 (Potential) | ||
| NP03534 |
SYIPRPNFSCFSLVFPVGQRFAAARTRFGPTLVASWPLCNDSETKVLTKWPSCSLI
|
56 | Drosophila melanogaster | NA | Amnesiac peptide 56 (Potential) | ||
| NP03535 |
NVGTLARDFQLPIPN
|
15 | Drosophila melanogaster | NA | IPNamide peptide | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03536 |
YIGSLARAGGLMTY
|
14 | Drosophila melanogaster | NA | MTYamide peptide | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03537 |
SVAALAAQGLLNAP
|
14 | Drosophila melanogaster | NA | NAP peptide | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03538 |
SLATLAKNGQLPTAEPGEDYGDADSGEPSEQ
|
31 | Drosophila melanogaster | NA | NPLP1-1 (Potential) | ||
| NP03539 |
NIATMARLQSAPSTHRDP
|
18 | Drosophila melanogaster | NA | NPLP1-2 (Potential) | ||
| NP03540 |
NVAAVARYNSQHGHIQRAGAE
|
21 | Drosophila melanogaster | NA | NPLP1-3 (Potential) | ||
| NP03541 |
NLGALKSSPVHGVQQ
|
15 | Drosophila melanogaster | NA | NPLP1-4 | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03542 |
EDEEMLLPAAAPDYADPMQSYWWYPSYAGYADLDWNDYRRAE
|
42 | Drosophila melanogaster | NA | NPLP1-5 (Potential) | ||
| NP03543 |
FLGRVLPPTRATASTHRSRL
|
20 | Drosophila melanogaster | NA | NPLP1-6 (Potential) | ||
| NP03544 |
TKAQGDFNEF
|
10 | Drosophila melanogaster | NA | Neuropeptide-like 2 | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03545 |
VVSVVPGAISHA
|
12 | Drosophila melanogaster | NA | SHA-peptide | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03546 |
SVHGLGPVVI
|
10 | Drosophila melanogaster | NA | VVI-amide peptide | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03547 |
QYYYGASPYAYSGGYYDSPYSY
|
22 | Drosophila melanogaster | NA | Neuropeptide-like 4 | 12171930# Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; # J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP03608 |
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ
|
73 | Drosophila melanogaster | NA | Ubiquitin-like protein 5 | ||
| NP03814 |
KPQRLRW
|
7 | Drosophila melanogaster | NPY | sNPF-3 | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03815 |
KPMRLRW
|
7 | Drosophila melanogaster | NPY | sNPF-4 | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03872 |
NDVNTMADAYKFLQDLDTYYGDRARVRF
|
28 | Drosophila melanogaster | NPY | Neuropeptide F | 10499420#Brown M.R., Crim J.W., Arata R.C., Cai H.N., Chun C., Shen P.; #Identification of a Drosophila brain-gut peptide related to the neuropeptide Y family.; #Peptides 20:1035-1042(1999). | |
| NP03873 |
AQRSPSLRLRF
|
11 | Drosophila melanogaster | NPY | RLRF peptide 1 | ||
| NP03874 |
SPSLRLRF
|
8 | Drosophila melanogaster | NPY | RLRF peptide 2 | ||
| NP03875 |
WFGDVNQKPI
|
10 | Drosophila melanogaster | NPY | sNPF peptide 2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP03876 |
SDPDMLNSIVE
|
11 | Drosophila melanogaster | NPY | sNPF-associated peptide | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP04965 |
GPSASSGLWFGPRL
|
14 | Drosophila melanogaster | Pyrokinin | Drm-PK-1 2-15 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP05070 |
GANMGLYAFPRV
|
12 | Drosophila melanogaster | Pyrokinin | CAP-1 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP05071 |
ASGLVAFPRV
|
10 | Drosophila melanogaster | Pyrokinin | CAP-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP05072 |
TGPSASSGLWFGPRL
|
15 | Drosophila melanogaster | Pyrokinin | CAP-3 | ||
| NP05073 |
QLQSNGEPAYRVRTPRL
|
17 | Drosophila melanogaster | Pyrokinin | Hug-gamma (Potential) | ||
| NP05074 |
SVPFKPRL
|
8 | Drosophila melanogaster | Pyrokinin | pyrokinin-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP05647 |
DEEHDTSEGNWLGSGPDPLDYADEEADSSYAEN
|
33 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 1(Potential) | ||
| NP05648 |
FIPINNRLSDVLQSLEEERLRDSLLQDFFDRVAGRDGSAV
|
40 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 2(Potential) | ||
| NP05649 |
PALLAGDDDAEADEATELQQ
|
20 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 3(Potential) | ||
| NP05650 |
DVSHQHY
|
7 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 4(Potential) | ||
| NP05651 |
AALSDSYDLRGKQQRFADFNSKFVAVR
|
27 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 5(Potential) | ||
| NP05652 |
SDLEGNGVGIGDDHEQALVHPWLYLWGE
|
28 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 6(Potential) | ||
| NP05653 |
APTSSFIGMR
|
10 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 1 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05654 |
APLAFVGLR
|
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 2 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05655 |
APTGFTGMR
|
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 3 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05656 |
APVNSFVGMR
|
10 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 4 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05657 |
APNGFLGMR
|
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 5 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 |